DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14505 and gskip

DIOPT Version :9

Sequence 1:NP_001036558.1 Gene:CG14505 / 37098 FlyBaseID:FBgn0034327 Length:119 Species:Drosophila melanogaster
Sequence 2:NP_001096457.1 Gene:gskip / 100125074 XenbaseID:XB-GENE-987914 Length:139 Species:Xenopus tropicalis


Alignment Length:111 Identity:36/111 - (32%)
Similarity:58/111 - (52%) Gaps:11/111 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VQSDENDFHALR---------EAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRTLEQVIYCVQ 59
            |..||::|..|.         ||:.:|:.......::.|::.||....|||||:...|...||::
 Frog    15 VYEDESEFRDLEGTDVKDMCLEAEAIVNDVLFAVGNMFVSKTLPCAVDVAYINVEIKEGTRYCLE 79

  Fly    60 LSRAGYRIVSYEFDDVADEVANCDTVYESAHQLLAGISPLYGEKYG 105
            |:.||.|:..|.||.:|:.:  |...:|:.:.||..:||.|.|.:|
 Frog    80 LTDAGLRVAGYAFDHLAEGL--CSQYHETVYSLLDSLSPAYREAFG 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14505NP_001036558.1 DUF727 15..116 CDD:283065 31/100 (31%)
gskipNP_001096457.1 DUF727 35..133 CDD:368379 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10358
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5208
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508955at2759
OrthoFinder 1 1.000 - - FOG0005233
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12490
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3011
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.100

Return to query results.
Submit another query.