DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18540 and CheA75a

DIOPT Version :9

Sequence 1:NP_611316.2 Gene:CG18540 / 37097 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster


Alignment Length:121 Identity:34/121 - (28%)
Similarity:51/121 - (42%) Gaps:11/121 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ERISRSEFGFSGTFFWNIDVDDSVMVEMRILSSYSGDESDYKLTPMSIQPQKFTEYVNTFYKDLL 116
            ||.....|.|.|..     .:|...|.:.:.||.:|| .::|...|.:......|....||...:
  Fly    51 ERALNGSFKFLGEM-----NNDDFKVSVELYSSPNGD-GEFKRMVMDVPQTSICECFKKFYVQFV 109

  Fly   117 LPNL--GNCTDLPVYENEFVPPWPKATYNFTRCALNGQGLPDILADGFYKGEAVIT 170
            .|:|  |..|:.||.:::|.|. |:..:......||.|..|..:..|..|  |:||
  Fly   110 QPSLKTGETTNFPVVDDDFCPV-PEGEFYVKNVILNTQDWPSQVPRGIVK--AIIT 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18540NP_611316.2 DUF1091 88..164 CDD:284008 20/77 (26%)
CheA75aNP_649035.2 DM8 85..180 CDD:214778 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459079
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.