DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18540 and CheA46a

DIOPT Version :9

Sequence 1:NP_611316.2 Gene:CG18540 / 37097 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster


Alignment Length:111 Identity:23/111 - (20%)
Similarity:46/111 - (41%) Gaps:29/111 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MNLRIERISR--------SEFGF---------SGTFFWNIDVDDSVMVEMRILSSYSGDESDYKL 94
            :..|||.||:        .||.|         :||..:::|:||...:...:|:...|   :::.
  Fly    24 LECRIESISKVFGDNETLFEFNFRVIGRQRLLNGTLNFHVDLDDDYEMSNEVLALKDG---EWES 85

  Fly    95 TPMSIQPQK-------FTEYVNTFYKDLLLPNLGNCTDLPVYENEF 133
            |.:|.:.:.       :.:|....:||..:|.  .....|:.:.|:
  Fly    86 TSVSARFKTCKYMAVIYDKYFAVSFKDSNIPK--GTEACPIKKGEY 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18540NP_611316.2 DUF1091 88..164 CDD:284008 8/53 (15%)
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369 7/44 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.