DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18540 and CG18539

DIOPT Version :9

Sequence 1:NP_611316.2 Gene:CG18540 / 37097 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster


Alignment Length:189 Identity:78/189 - (41%)
Similarity:117/189 - (61%) Gaps:5/189 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MISFCISSLLSVCIFANLYNGCAAKPNWEATPLSIGGTTTNPSAMDMNLRIERISRSEFGFSGTF 65
            |||.|  |||.: :...|.:||.|..|||..|||:...:::.|.:.:..:|:|:.||::.||.|.
  Fly     1 MISCC--SLLFL-LATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTL 62

  Fly    66 FWNIDVDDSVMVEMRILSSYSGDESDYKLTPMSIQPQKFTEYVNTFYKDLLLPNLGNCTDLPVYE 130
            .||.|||...|||..:....||||.|||:.|.||..|.|.||:|.||||..:.|:|:|:::..::
  Fly    63 DWNYDVDKDTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFD 127

  Fly   131 NEFVPPWPKATYNFTRCALNGQGLPDILADGFYKGEAVITAQPNLEVTVSVVLRIRTKM 189
            .:||||||:..|...:|..:|:|||||..:||||.|..:|.|.:...|  :::::..|:
  Fly   128 GDFVPPWPRNVYKLDKCVASGEGLPDIAPEGFYKLEYKMTGQVDWGFT--LIVKVSPKV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18540NP_611316.2 DUF1091 88..164 CDD:284008 36/75 (48%)
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 37/76 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459030
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.