DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18540 and CG18538

DIOPT Version :9

Sequence 1:NP_611316.2 Gene:CG18540 / 37097 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_611314.2 Gene:CG18538 / 37095 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster


Alignment Length:157 Identity:61/157 - (38%)
Similarity:92/157 - (58%) Gaps:12/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CIFANLYNGCAA--KPNWEATPLSIGGTTTNPSAMDMNLRIERISRSEFG----FSGTFFWNIDV 71
            |..|.|   |.|  ...|:..|:||...:::.|.:.::::||||:|..||    .|||   .|.:
  Fly     5 CFIAEL---CMALLLRKWDYEPISIETHSSDESLIKLDMKIERINRGVFGLTPRLSGT---TIRL 63

  Fly    72 DDSVMVEMRILSSYSGDESDYKLTPMSIQPQKFTEYVNTFYKDLLLPNLGNCTDLPVYENEFVPP 136
            .....||..:|.|.:||.|||||.|.:|..|...|::||:|||:.:.|..:|:::|.:|.:|.||
  Fly    64 MKPWYVEANVLRSSTGDVSDYKLLPWAIPKQSLYEHLNTYYKDVSMKNFKHCSNIPQFEGKFQPP 128

  Fly   137 WPKATYNFTRCALNGQGLPDILADGFY 163
            .||.||...:|.::|.|||:|:..|||
  Fly   129 LPKQTYFGNKCVIDGDGLPEIVPAGFY 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18540NP_611316.2 DUF1091 88..164 CDD:284008 35/76 (46%)
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 34/74 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459028
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.