DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18540 and CG18537

DIOPT Version :9

Sequence 1:NP_611316.2 Gene:CG18540 / 37097 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster


Alignment Length:184 Identity:68/184 - (36%)
Similarity:102/184 - (55%) Gaps:1/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSLLSVCIFANLYNGCAAKPNWEATPLSIGGTTTNPSAMDMNLRIERISRSEFGFSGTFFWNIDV 71
            ||:| :.:...|.:.|.|...||..|:.|..|:::.|.:.:...|.|:.|.:||.|....||.|.
  Fly     6 SSVL-ILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKLESSIVRLGRGKFGISARVEWNYDT 69

  Fly    72 DDSVMVEMRILSSYSGDESDYKLTPMSIQPQKFTEYVNTFYKDLLLPNLGNCTDLPVYENEFVPP 136
            .:..|||..:..|.|||||||||.|.:|..|.|.:|:|::|||:::.|...|:::|.::.:|.||
  Fly    70 TEETMVEAVVYRSNSGDESDYKLLPWAIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPP 134

  Fly   137 WPKATYNFTRCALNGQGLPDILADGFYKGEAVITAQPNLEVTVSVVLRIRTKMF 190
            |||.||...:|....:|.|||:..||||.....|.......:...:.:|..|||
  Fly   135 WPKRTYIGDKCVFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINKMF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18540NP_611316.2 DUF1091 88..164 CDD:284008 34/75 (45%)
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 40/87 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459031
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.