DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18540 and CG14502

DIOPT Version :9

Sequence 1:NP_611316.2 Gene:CG18540 / 37097 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster


Alignment Length:168 Identity:62/168 - (36%)
Similarity:103/168 - (61%) Gaps:2/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 CAAKPNWEATPLSIGGTTTNPSAMDMNLRIERISRSEFGFSGTFFWNIDVDDSVMVEMRILSSYS 86
            |..|..|:..||||...||:.:.:.:..::||:.|.|:..||...:....:|:.|||.....|.|
  Fly    22 CNGKRKWDYEPLSIETYTTDETKLKIAAKVERVGRGEYALSGNIEFKYTPEDNTMVEAMAYRSTS 86

  Fly    87 GDESDYKLTPMSIQPQKFTEYVNTFYKDLLLPNLGNCTDLPVYENEFVPPWPKATYNFTRCALNG 151
            |||:|||:.|.||..|.:.|::|:.||:::|||||:|::|..::.:|.||||:.||...:|..|.
  Fly    87 GDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGKFEPPWPQDTYVLEKCVANS 151

  Fly   152 QGLPDILADGFYKGEAVITAQPNLEVTVSVVLRIRTKM 189
            .|.||::.:|:||....:| .| ::....::::|.||:
  Fly   152 DGFPDMVPEGYYKVNFTLT-NP-VDWGFILIVKITTKL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18540NP_611316.2 DUF1091 88..164 CDD:284008 33/75 (44%)
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 34/76 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459027
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.