DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18539 and CG34028

DIOPT Version :9

Sequence 1:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001033838.1 Gene:CG34028 / 3885648 FlyBaseID:FBgn0054028 Length:189 Species:Drosophila melanogaster


Alignment Length:183 Identity:51/183 - (27%)
Similarity:93/183 - (50%) Gaps:8/183 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MISCCSLLFLLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWN 65
            ::.||.      :::....::.:.|.|...|....:::|||....|.::|.||.:|..|..|.:|
  Fly    13 LVMCCD------SIMGGSIRSKQTWTYRIRSTRMATNNESLAGGETHLEREGRGEYTMSGYLYFN 71

  Fly    66 YDVDKDTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFDGDF 130
            .|:.:|...|.:::..:.|.. .||:.|:|:|:...:..:|.||||..:.:..:|||..||. |.
  Fly    72 VDIPQDLEGEVNIYRSNDGGA-TYKLEPYSVPRTVVYHTMNTFYKDIVMSSAANCSNFPQFK-DK 134

  Fly   131 VPPWPRNVYKLDKCVASGEGLPDIAPEGFYKLEYKMTGQVDWGFTLIVKVSPK 183
            :.......:..:||:.|.:|.|...|:|.||.|.:..|.::..|..:|:|:.|
  Fly   135 IELIRAQTFTYNKCLLSPDGFPTYLPDGIYKFEMQSFGMIELFFEALVEVTQK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 24/76 (32%)
CG34028NP_001033838.1 DUF1091 81..166 CDD:284008 26/86 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459036
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.