DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18539 and CheA46a

DIOPT Version :9

Sequence 1:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027399.1 Gene:CheA46a / 3772338 FlyBaseID:FBgn0262594 Length:177 Species:Drosophila melanogaster


Alignment Length:66 Identity:15/66 - (22%)
Similarity:32/66 - (48%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVDKDTMVEADVHHCSSG 84
            :||.....|.:|.. :..:|:|.:...::  :|| ....:.||:::.|:|.|..:..:|.....|
  Fly    21 RAGLECRIESISKV-FGDNETLFEFNFRV--IGR-QRLLNGTLNFHVDLDDDYEMSNEVLALKDG 81

  Fly    85 D 85
            :
  Fly    82 E 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 0/1 (0%)
CheA46aNP_001027399.1 DUF1091 88..>154 CDD:301369
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459110
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.