DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18539 and CheA56a

DIOPT Version :9

Sequence 1:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_001027438.1 Gene:CheA56a / 3772206 FlyBaseID:FBgn0262595 Length:180 Species:Drosophila melanogaster


Alignment Length:182 Identity:39/182 - (21%)
Similarity:73/182 - (40%) Gaps:23/182 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFLLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVDKDT 72
            |.:|.|:.:...|:.....:|.:.... .|.|:|.....::  ||| :...:.||.:..|:|:..
  Fly    10 LLILWTVSVGSKKSNYEVRFESIDAVK-GSTETLFLYQLRL--LGR-NRMINGTLIFLEDLDETF 70

  Fly    73 MVEADVHHCSSGDEDDYKMMPW------SIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFDGDFV 131
            .|..:.|...:|    |    |      :...:| .|:.|.:|...|:  |....:.:...|..:
  Fly    71 DVLFESHAFKNG----Y----WVKGIVNAAASKP-CEFFNRYYISFFL--VKSTESNLPTTGAEM 124

  Fly   132 PPWPRNVYKLDKCVASGEGLPDIAPEGF--YKLEYKMTGQVDWGFTLIVKVS 181
            .|:.:..|.:...|.|.|..|.|..:|.  :.:.|...|:...|..|.:.::
  Fly   125 CPFRKGTYFVKNGVVSTEDWPPIVFKGLNRFTISYLKNGECVGGVQLTISIA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 17/84 (20%)
CheA56aNP_001027438.1 DUF1091 97..179 CDD:301369 18/82 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.