DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18539 and CG18537

DIOPT Version :9

Sequence 1:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster


Alignment Length:181 Identity:93/181 - (51%)
Similarity:121/181 - (66%) Gaps:2/181 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SLLFLLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVDK 70
            |:|.|||..||..|.|.|.|||||:.:.:.|||:||:|:.:.|.||||..:..|..::||||..:
  Fly     7 SVLILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKLESSIVRLGRGKFGISARVEWNYDTTE 71

  Fly    71 DTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFDGDFVPPWP 135
            :|||||.|:..:||||.|||::||:||||.|::|||.:|||..:||...|||:.||.|.|.||||
  Fly    72 ETMVEAVVYRSNSGDESDYKLLPWAIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPPWP 136

  Fly   136 RNVYKLDKCVASGEGLPDIAPEGFYKLEYKMTG--QVDWGFTLIVKVSPKV 184
            :..|..||||...||.|||.|.||||:.:..||  |..|.|..|.|:..|:
  Fly   137 KRTYIGDKCVFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINKM 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 45/76 (59%)
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 51/87 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459026
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.