DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18539 and CG18536

DIOPT Version :9

Sequence 1:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster
Sequence 2:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster


Alignment Length:182 Identity:95/182 - (52%)
Similarity:127/182 - (69%) Gaps:10/182 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CSLLFLLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLDWNYDVD 69
            |.|..|.|        |.|.|:|||:.||:.|||||.||...||:|||||||..|..|:|.||.:
  Fly    17 CILFHLTA--------ASRKWDYEPILLTATSSDESKLKFEAKIERLGRSDYGLSAILEWKYDTN 73

  Fly    70 KDTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFDGDFVPPW 134
            ::|||||..:..:||||.|||::||:||||||::|:|.:|||...||:|:|||:.:::..|.|||
  Fly    74 EETMVEAQAYRSNSGDESDYKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSNLPKYEDKFQPPW 138

  Fly   135 PRNVYKLDKCVASGEGLPDIAPEGFYKLEYKM--TGQVDWGFTLIVKVSPKV 184
            |:|.||||||...|:|||:|||.||||:.:..  .||..||||.:.|::.|:
  Fly   139 PKNTYKLDKCKIGGDGLPEIAPPGFYKIVFTKFGPGQPTWGFTAVFKLTNKI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 46/76 (61%)
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 46/76 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459024
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.