DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18538 and CheA87a

DIOPT Version :9

Sequence 1:NP_611314.2 Gene:CG18538 / 37095 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_650280.1 Gene:CheA87a / 41642 FlyBaseID:FBgn0038142 Length:183 Species:Drosophila melanogaster


Alignment Length:139 Identity:38/139 - (27%)
Similarity:59/139 - (42%) Gaps:21/139 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IETHSSDESLIKLDMKIERINRGVFGLTPRLSG---TTIRLMKPWYVEANVLRSSTGDVSDY-KL 86
            :|..:.|.|.::..::|........    ::||   ...||...|.|...|.||...| .|| |:
  Fly    36 LEKVTEDTSYLRSRLRIAESEENEL----KVSGYLDLNQRLDNDWTVVLKVSRSPDSD-GDYEKV 95

  Fly    87 LPWAIPKQSLYEHLNTYYKDVSMKNFKHCSNIPQFEGKFQP---PLPKQTYFGNKCVIDGDGLPE 148
            |.:   :..|.:.:.:||||:..:..|..||.|      .|   ||||:.|.......:...|.:
  Fly    96 LTF---EMQLCDFMKSYYKDIFYERIKEYSNAP------HPSSCPLPKERYVLEDYPFNVKLLKK 151

  Fly   149 IVPAGFYLI 157
            ::..|||.|
  Fly   152 LMSPGFYRI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 23/78 (29%)
CheA87aNP_650280.1 DM8 91..181 CDD:214778 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.