DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18538 and CheA86a

DIOPT Version :9

Sequence 1:NP_611314.2 Gene:CG18538 / 37095 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_001027174.1 Gene:CheA86a / 3772145 FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster


Alignment Length:171 Identity:41/171 - (23%)
Similarity:67/171 - (39%) Gaps:23/171 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLRKWDYEPISIETHSSDESLIKLDMK------IERINRGVFGLTPRLSGTTIRLMKPWYVEAN 72
            ||..:..||.|.:.. :|:|:....|:.      .|||..|.|.:...|.....::....|  .|
  Fly    17 LLQAQMSYEAIFVSV-TSEENSKPFDLSNLRLIGRERILNGTFEILEDLDDEHFQISVEIY--TN 78

  Fly    73 VLRSSTGDVSDYKLLPWAIPKQ---SLYEHLNTYYKDVSMKNFKHCSNIPQFEGKFQPPLPKQTY 134
            ..|.     .:|||||.::|:|   :.::....|::|.    .|:..|...|........||..|
  Fly    79 PARD-----GNYKLLPMSVPRQGVCTFFKKYGFYFRDC----IKNGINTDLFLNTTSCLFPKGHY 134

  Fly   135 FGNKCVIDGDGLPEIVPAGFYLIVIKCYGPGQP--TWNTTS 173
            :.....|:....|:|:..|....:...|....|  ::|.||
  Fly   135 YLKNVTINVQNWPKIMQRGLCRHIAFFYKNNVPMGSYNLTS 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 19/77 (25%)
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:301369 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459071
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.