DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18538 and CG18539

DIOPT Version :9

Sequence 1:NP_611314.2 Gene:CG18538 / 37095 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611315.3 Gene:CG18539 / 37096 FlyBaseID:FBgn0034325 Length:185 Species:Drosophila melanogaster


Alignment Length:184 Identity:79/184 - (42%)
Similarity:114/184 - (61%) Gaps:9/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CFIAELCMALLL------RKWDYEPISIETHSSDESLIKLDMKIERINRGVFGLTPRLSGTTIRL 63
            |.:..|...||:      |.|:|||:|:.::||||||:|:..||:|:.|..:..:..|. ....:
  Fly     5 CSLLFLLATLLIDGCKAGRNWEYEPLSLTSYSSDESLLKITTKIDRLGRSDYAFSMTLD-WNYDV 68

  Fly    64 MKPWYVEANVLRSSTGDVSDYKLLPWAIPKQSLYEHLNTYYKDVSMKNFKHCSNIPQFEGKFQPP 128
            .|...|||:|...|:||..|||::||:||||..:|:||.:|||..:||..||||:.||:|.|.||
  Fly    69 DKDTMVEADVHHCSSGDEDDYKMMPWSIPKQPFFEYLNGFYKDAFIKNVGHCSNMVQFDGDFVPP 133

  Fly   129 LPKQTYFGNKCVIDGDGLPEIVPAGFYLIVIKCYGPGQPTWNTTSVFKITPKLM 182
            .|:..|..:|||..|:|||:|.|.|||.:..|.  .||..|..|.:.|::||::
  Fly   134 WPRNVYKLDKCVASGEGLPDIAPEGFYKLEYKM--TGQVDWGFTLIVKVSPKVI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 41/74 (55%)
CG18539NP_611315.3 DUF1091 85..162 CDD:284008 42/76 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459022
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.