DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18538 and CG18537

DIOPT Version :9

Sequence 1:NP_611314.2 Gene:CG18538 / 37095 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster
Sequence 2:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster


Alignment Length:181 Identity:101/181 - (55%)
Similarity:127/181 - (70%) Gaps:15/181 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RCFIAELCMALLLRKWDYEPISIETHSSDESLIKLDMKIERINRGVFGLTPRLS---GTTIRLMK 65
            ||..|        |||:|||:.|.|.|||:|||||:..|.|:.||.||::.|:.   .||...| 
  Fly    19 RCGAA--------RKWEYEPVLILTTSSDDSLIKLESSIVRLGRGKFGISARVEWNYDTTEETM- 74

  Fly    66 PWYVEANVLRSSTGDVSDYKLLPWAIPKQSLYEHLNTYYKDVSMKNFKHCSNIPQFEGKFQPPLP 130
               |||.|.||::||.|||||||||||||:.|::||:|||||.||||..|||:|||:||||||.|
  Fly    75 ---VEAVVYRSNSGDESDYKLLPWAIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPPWP 136

  Fly   131 KQTYFGNKCVIDGDGLPEIVPAGFYLIVIKCYGPGQPTWNTTSVFKITPKL 181
            |:||.|:|||.:.:|.|:|||.|||.|:..|.||.||:|:...:|||..|:
  Fly   137 KRTYIGDKCVFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINKM 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 53/74 (72%)
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 61/87 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459018
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.