DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18537 and LOC4577444

DIOPT Version :10

Sequence 1:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_001237421.2 Gene:LOC4577444 / 4577444 VectorBaseID:AGAMI1_000375 Length:237 Species:Anopheles gambiae


Alignment Length:98 Identity:25/98 - (25%)
Similarity:44/98 - (44%) Gaps:16/98 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 RSNSGDESDYKLLPWAIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQP-----PWPKRTY 140
            ||..|: :.:...|..:..:.|..::|.||:: ....|...:|:|     |.|     |:||.||
Mosquito   130 RSAQGN-NQFNAYPMKLAAKPFCQFVNMYYRE-YQHLFLKYTNLP-----FVPPEGLCPFPKGTY 187

  Fly   141 IGDKCVFEAEGFPDIVPPGFYK----IIFNCTG 169
            ......|::...|.:||.|.::    ::...||
Mosquito   188 WAKDAHFDSSVIPVVVPEGLWRATTDLVDTVTG 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18537NP_611313.1 DUF1091 75..163 CDD:461928 23/90 (26%)
LOC4577444XP_001237421.2 None

Return to query results.
Submit another query.