DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18537 and CG34028

DIOPT Version :9

Sequence 1:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001033838.1 Gene:CG34028 / 3885648 FlyBaseID:FBgn0054028 Length:189 Species:Drosophila melanogaster


Alignment Length:189 Identity:57/189 - (30%)
Similarity:99/189 - (52%) Gaps:18/189 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILLAVWLISRCGAA----RKWEYEPVLILTTSSDDSLIKLESSIVRLGRGKFGISARVEWNYDT 69
            |::|.:...|..|.:    :.|.|........::::||...|:.:.|.|||::.:|..:.:|.|.
  Fly    10 LLILVMCCDSIMGGSIRSKQTWTYRIRSTRMATNNESLAGGETHLEREGRGEYTMSGYLYFNVDI 74

  Fly    70 TEETMVEAVVYRSNSGDESDYKLLPWAIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPP 134
            .::...|..:||||.|. :.|||.|:::|:...|..:|::|||::|.:.|.|||.||||.|.: .
  Fly    75 PQDLEGEVNIYRSNDGG-ATYKLEPYSVPRTVVYHTMNTFYKDIVMSSAANCSNFPQFKDKIE-L 137

  Fly   135 WPKRTYIGDKCVFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIF-----KIINKMF 188
            ...:|:..:||:...:|||..:|.|.||.       :..|:..|.:|     ::..|.|
  Fly   138 IRAQTFTYNKCLLSPDGFPTYLPDGIYKF-------EMQSFGMIELFFEALVEVTQKTF 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 35/87 (40%)
CG34028NP_001033838.1 DUF1091 81..166 CDD:284008 35/86 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459037
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.