DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18537 and CheA86a

DIOPT Version :10

Sequence 1:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027174.1 Gene:CheA86a / 3772145 FlyBaseID:FBgn0261291 Length:189 Species:Drosophila melanogaster


Alignment Length:166 Identity:41/166 - (24%)
Similarity:70/166 - (42%) Gaps:17/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SVLILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKLESSIVRLGRGKFGISARVEWNYDTTE 71
            :||:||..  |.:.....:..||.:.:..||.::|.....|::..:||.:. ::...|...|..:
  Fly     5 TVLVLLIG--IPKLLLQAQMSYEAIFVSVTSEENSKPFDLSNLRLIGRERI-LNGTFEILEDLDD 66

  Fly    72 ETMVEAVVYRSNSGDESDYKLLPWAIPKQ---TFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQP 133
            |....:|...:|...:.:|||||.::|:|   ||:.....|::|.|....    |...|......
  Fly    67 EHFQISVEIYTNPARDGNYKLLPMSVPRQGVCTFFKKYGFYFRDCIKNGI----NTDLFLNTTSC 127

  Fly   134 PWPKRTYIGDKCVFEAEGFPDIVPPG-------FYK 162
            .:||..|.........:.:|.|:..|       |||
  Fly   128 LFPKGHYYLKNVTINVQNWPKIMQRGLCRHIAFFYK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18537NP_611313.1 DUF1091 75..163 CDD:461928 25/98 (26%)
CheA86aNP_001027174.1 DUF1091 <126..174 CDD:472716 9/38 (24%)

Return to query results.
Submit another query.