DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18537 and CheA84a

DIOPT Version :9

Sequence 1:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027150.1 Gene:CheA84a / 3771856 FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster


Alignment Length:196 Identity:48/196 - (24%)
Similarity:81/196 - (41%) Gaps:41/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKLESSIVRLGR-----GKFGISARVE-WNY 67
            |..:.:.||.:..|.....||...|..||:..:|... |.|..|||     |.|.:...:: .::
  Fly     5 LFCVLIMLIGKTCALIPRTYETRFISITSNGTNLFDF-SQIRFLGRERMANGTFELKEDLDNESF 68

  Fly    68 DTTEETMVEAVVYRSNSGDESDYKLLPWAIPKQT-------FYDYLNSYYKDVIMKNFA----PC 121
            ....||.:::|      || .:||.||:..|||:       ::.|.....|..:..:|.    ||
  Fly    69 SVVGETFIDSV------GD-GEYKQLPFTAPKQSVCTALKAYWSYFEPSIKYGVKTDFPAHTHPC 126

  Fly   122 SNVPQFKGKFQPPWPKRTYIGDKCVFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINK 186
                        |.||..|.....|.:.:.:|.|:|.|:.|.:.|....|:    :.|..:|:::
  Fly   127 ------------PLPKGIYYIKDVVLKNDNWPVIMPRGYLKAVANLFKNDE----YGGSLEIVSQ 175

  Fly   187 M 187
            :
  Fly   176 I 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 24/98 (24%)
CheA84aNP_001027150.1 DUF1091 <124..153 CDD:284008 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459094
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.