DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18537 and CG14502

DIOPT Version :9

Sequence 1:NP_611313.1 Gene:CG18537 / 37094 FlyBaseID:FBgn0034323 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster


Alignment Length:180 Identity:84/180 - (46%)
Similarity:130/180 - (72%) Gaps:5/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VLILLAVWLISRCGAARKWEYEPVLILTTSSDDSLIKLESSIVRLGRGKFGISARVEWNYDTTEE 72
            |||||   ::.:|...|||:|||:.|.|.::|::.:|:.:.:.|:|||::.:|..:|:.|...:.
  Fly    13 VLILL---IVDQCNGKRKWDYEPLSIETYTTDETKLKIAAKVERVGRGEYALSGNIEFKYTPEDN 74

  Fly    73 TMVEAVVYRSNSGDESDYKLLPWAIPKQTFYDYLNSYYKDVIMKNFAPCSNVPQFKGKFQPPWPK 137
            |||||:.|||.||||:|||::|::||||.:.:::||:||:|::.|...|||:.:|.|||:||||:
  Fly    75 TMVEAMAYRSTSGDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGKFEPPWPQ 139

  Fly   138 RTYIGDKCVFEAEGFPDIVPPGFYKIIFNCTGPDQPSWSFIGIFKIINKM 187
            .||:.:|||..::||||:||.|:||:.|..|.|  ..|.||.|.||..|:
  Fly   140 DTYVLEKCVANSDGFPDMVPEGYYKVNFTLTNP--VDWGFILIVKITTKL 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18537NP_611313.1 DUF1091 75..163 CDD:284008 48/87 (55%)
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 40/76 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459025
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.