DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18536 and CheA75a

DIOPT Version :10

Sequence 1:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_649035.2 Gene:CheA75a / 40011 FlyBaseID:FBgn0036783 Length:184 Species:Drosophila melanogaster


Alignment Length:183 Identity:37/183 - (20%)
Similarity:66/183 - (36%) Gaps:23/183 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KWDYEPILLTATSSDESKLKFEAKIERL--------------GRSDYGLSAILEWKYD-----TN 73
            ||....:||......:.:..:|...|||              |....|....|...:.     .|
  Fly     2 KWLVIIVLLQLLEKIKCEQSYEVTNERLEPFEGDSQTLVLFDGLKTIGRERALNGSFKFLGEMNN 66

  Fly    74 EETMVEAQAYRSNSGDESDYKLLPWAIPKQPFYDYINTYYKDVISKNL--GYCSNLPKYEDKFQP 136
            ::..|..:.|.|.:|| .::|.:...:|:....:....:|...:..:|  |..:|.|..:|.|.|
  Fly    67 DDFKVSVELYSSPNGD-GEFKRMVMDVPQTSICECFKKFYVQFVQPSLKTGETTNFPVVDDDFCP 130

  Fly   137 PWPKNTYKLDKCKIGGDGLPEIAPPGFYKIVFTKFGPGQPTWGFTAVFKLTNK 189
            . |:..:.:....:.....|...|.|..|.:.|.|..|:...|.....|:.::
  Fly   131 V-PEGEFYVKNVILNTQDWPSQVPRGIVKAIITFFSGGKNVGGLIVEVKIEDR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18536NP_611312.1 DUF1091 78..166 CDD:461928 19/89 (21%)
CheA75aNP_649035.2 DM8 85..180 CDD:214778 20/95 (21%)

Return to query results.
Submit another query.