DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18536 and CG34028

DIOPT Version :9

Sequence 1:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_001033838.1 Gene:CG34028 / 3885648 FlyBaseID:FBgn0054028 Length:189 Species:Drosophila melanogaster


Alignment Length:167 Identity:53/167 - (31%)
Similarity:84/167 - (50%) Gaps:4/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 ASRKWDYEPILLTATSSDESKLKFEAKIERLGRSDYGLSAILEWKYDTNEETMVEAQAYRSNSGD 89
            :.:.|.|........:::||....|..:||.||.:|.:|..|.:..|..::...|...||||.|.
  Fly    27 SKQTWTYRIRSTRMATNNESLAGGETHLEREGRGEYTMSGYLYFNVDIPQDLEGEVNIYRSNDGG 91

  Fly    90 ESDYKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSNLPKYEDKFQPPWPKNTYKLDKCKIGGDG 154
             :.|||.|:::|:...|..:||:|||::..:...|||.|:::||.: .....|:..:||.:..||
  Fly    92 -ATYKLEPYSVPRTVVYHTMNTFYKDIVMSSAANCSNFPQFKDKIE-LIRAQTFTYNKCLLSPDG 154

  Fly   155 LPEIAPPGFYKIVFTKFGPGQPTWGFTAVFKLTNKIF 191
            .|...|.|.||.....|  |.....|.|:.::|.|.|
  Fly   155 FPTYLPDGIYKFEMQSF--GMIELFFEALVEVTQKTF 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 26/76 (34%)
CG34028NP_001033838.1 DUF1091 81..166 CDD:284008 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459035
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.