DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18536 and CG18540

DIOPT Version :9

Sequence 1:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_611316.2 Gene:CG18540 / 37097 FlyBaseID:FBgn0034326 Length:190 Species:Drosophila melanogaster


Alignment Length:183 Identity:76/183 - (41%)
Similarity:108/183 - (59%) Gaps:11/183 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VCI---LFHLTAASRKWDYEPILLTATSSDESKLKFEAKIERLGRSDYGLSAILEWKYDTNEETM 77
            |||   |::..||...|:..|:.:..|:::.|.:....:|||:.||::|.|....|..|.::..|
  Fly    12 VCIFANLYNGCAAKPNWEATPLSIGGTTTNPSAMDMNLRIERISRSEFGFSGTFFWNIDVDDSVM 76

  Fly    78 VEAQAYRSNSGDESDYKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSNLPKYEDKFQPPWPKNT 142
            ||.:...|.|||||||||.|.:|..|.|.:|:||:|||::..|||.|::||.||::|.|||||.|
  Fly    77 VEMRILSSYSGDESDYKLTPMSIQPQKFTEYVNTFYKDLLLPNLGNCTDLPVYENEFVPPWPKAT 141

  Fly   143 YKLDKCKIGGDGLPEIAPPGFYK--IVFTKFGPGQPTWGFT--AVFKLTNKIF 191
            |...:|.:.|.|||:|...||||  .|.|    .||....|  .|.::..|:|
  Fly   142 YNFTRCALNGQGLPDILADGFYKGEAVIT----AQPNLEVTVSVVLRIRTKMF 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 43/78 (55%)
CG18540NP_611316.2 DUF1091 88..164 CDD:284008 41/75 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459029
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.