DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18536 and CG18538

DIOPT Version :9

Sequence 1:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_611314.2 Gene:CG18538 / 37095 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster


Alignment Length:189 Identity:99/189 - (52%)
Similarity:122/189 - (64%) Gaps:19/189 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IGIVCILFHLTAA--SRKWDYEPILLTATSSDESKLKFEAKIERLGRSDYGLSAILE-------- 67
            :.:.|.:..|..|  .||||||||.:...|||||.:|.:.||||:.|..:||:..|.        
  Fly     1 MSVRCFIAELCMALLLRKWDYEPISIETHSSDESLIKLDMKIERINRGVFGLTPRLSGTTIRLMK 65

  Fly    68 -WKYDTNEETMVEAQAYRSNSGDESDYKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSNLPKYE 131
             |        .|||...||::||.|||||||||||||..|:::|||||||..||..:|||:|::|
  Fly    66 PW--------YVEANVLRSSTGDVSDYKLLPWAIPKQSLYEHLNTYYKDVSMKNFKHCSNIPQFE 122

  Fly   132 DKFQPPWPKNTYKLDKCKIGGDGLPEIAPPGFYKIVFTKFGPGQPTWGFTAVFKLTNKI 190
            .|||||.||.||..:||.|.|||||||.|.|||.||...:|||||||..|:|||:|.|:
  Fly   123 GKFQPPLPKQTYFGNKCVIDGDGLPEIVPAGFYLIVIKCYGPGQPTWNTTSVFKITPKL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 52/76 (68%)
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 51/74 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459019
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.