DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18536 and CheA29a

DIOPT Version :9

Sequence 1:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster
Sequence 2:NP_788004.1 Gene:CheA29a / 246659 FlyBaseID:FBgn0053194 Length:180 Species:Drosophila melanogaster


Alignment Length:144 Identity:30/144 - (20%)
Similarity:52/144 - (36%) Gaps:8/144 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ESKLKFEAKIERLGRSDYGLSAILEWKYDTNEETMVEAQAYRSNSGDESDYKLLPWAIPKQPFYD 107
            |.:..|...:..:|| :..|:..:..:.|.::...|........:|:.:...:.....|...|.:
  Fly    40 EKETLFTCSVRLVGR-ERMLNGSIMHQVDLDDSFDVWMDILHFKNGEWAQGNIKVRTKPCDWFTN 103

  Fly   108 YINTYYKDVISKNLGYCSNLPKYEDKFQPPWPKNTYKLDKCKIGGDGLPEIAPPGFYKIVFTKFG 172
            |...|:..::..     ||||..::  ...:||..|.|...||.....|.|...|..:.......
  Fly   104 YFGKYFLPLVKD-----SNLPPIQE--MCVFPKGEYYLRITKIEPQNWPPILYRGLNQFNINYVR 161

  Fly   173 PGQPTWGFTAVFKL 186
            .|:.|.|...|..|
  Fly   162 DGKSTGGIQFVIDL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 17/76 (22%)
CheA29aNP_788004.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459117
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.