DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14502 and CG34028

DIOPT Version :9

Sequence 1:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001033838.1 Gene:CG34028 / 3885648 FlyBaseID:FBgn0054028 Length:189 Species:Drosophila melanogaster


Alignment Length:191 Identity:60/191 - (31%)
Similarity:91/191 - (47%) Gaps:15/191 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLPRLLL-----PIIGGVLILLIVDQCNGKRKWDYEPLSIETYTTDETKLKIAAKVERVGRGEYA 60
            |.|.|:|     .|:||.:        ..|:.|.|...|....|.:|:.......:||.|||||.
  Fly     7 MPPLLILVMCCDSIMGGSI--------RSKQTWTYRIRSTRMATNNESLAGGETHLEREGRGEYT 63

  Fly    61 LSGNIEFKYTPEDNTMVEAMAYRSTSGDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSN 125
            :||.:.|......:...|...|||..|... ||:.|:|:|:......||:.||::|:.:..:|||
  Fly    64 MSGYLYFNVDIPQDLEGEVNIYRSNDGGAT-YKLEPYSVPRTVVYHTMNTFYKDIVMSSAANCSN 127

  Fly   126 LIKFDGKFEPPWPQDTYVLEKCVANSDGFPDMVPEGYYKVNFTLTNPVDWGFILIVKITTK 186
            ..:|..|.|....| |:...||:.:.||||..:|:|.||........::..|..:|::|.|
  Fly   128 FPQFKDKIELIRAQ-TFTYNKCLLSPDGFPTYLPDGIYKFEMQSFGMIELFFEALVEVTQK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 27/76 (36%)
CG34028NP_001033838.1 DUF1091 81..166 CDD:284008 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459032
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.