DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14502 and CheA84a

DIOPT Version :9

Sequence 1:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001027150.1 Gene:CheA84a / 3771856 FlyBaseID:FBgn0261290 Length:180 Species:Drosophila melanogaster


Alignment Length:186 Identity:45/186 - (24%)
Similarity:73/186 - (39%) Gaps:48/186 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLILLIVDQCNGKRKWDYEPLSIET----YTTDETKLKIAAKVERVGRGEYALSGNIEFKYTPED 73
            |||:||...|      ...|.:.||    .|::.|.|...:::..:|| |...:|..|.|...::
  Fly     8 VLIMLIGKTC------ALIPRTYETRFISITSNGTNLFDFSQIRFLGR-ERMANGTFELKEDLDN 65

  Fly    74 NTM-VEAMAYRSTSGDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGKFEP-- 135
            .:. |....:..:.|| .:||.:||:.|||..                  |:.|..:...|||  
  Fly    66 ESFSVVGETFIDSVGD-GEYKQLPFTAPKQSV------------------CTALKAYWSYFEPSI 111

  Fly   136 ---------------PWPQDTYVLEKCVANSDGFPDMVPEGYYKVNFTLTNPVDWG 176
                           |.|:..|.::..|..:|.:|.::|.||.|....|....::|
  Fly   112 KYGVKTDFPAHTHPCPLPKGIYYIKDVVLKNDNWPVIMPRGYLKAVANLFKNDEYG 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 22/93 (24%)
CheA84aNP_001027150.1 DUF1091 <124..153 CDD:284008 7/28 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459087
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.