DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14502 and CG18538

DIOPT Version :9

Sequence 1:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_611314.2 Gene:CG18538 / 37095 FlyBaseID:FBgn0034324 Length:182 Species:Drosophila melanogaster


Alignment Length:169 Identity:73/169 - (43%)
Similarity:107/169 - (63%) Gaps:9/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RKWDYEPLSIETYTTDETKLKIAAKVERVGRGEYA----LSGNIEFKYTPEDNTMVEAMAYRSTS 86
            |||||||:||||:::||:.:|:..|:||:.||.:.    |||.......|   ..|||...||::
  Fly    17 RKWDYEPISIETHSSDESLIKLDMKIERINRGVFGLTPRLSGTTIRLMKP---WYVEANVLRSST 78

  Fly    87 GDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGKFEPPWPQDTYVLEKCVANS 151
            ||.:|||::|::||||...|.:|::||:|.:.|...|||:.:|:|||:||.|:.||...|||.:.
  Fly    79 GDVSDYKLLPWAIPKQSLYEHLNTYYKDVSMKNFKHCSNIPQFEGKFQPPLPKQTYFGNKCVIDG 143

  Fly   152 DGFPDMVPEGYYKVNFTLTNP--VDWGFILIVKITTKLV 188
            ||.|::||.|:|.:......|  ..|....:.|||.||:
  Fly   144 DGLPEIVPAGFYLIVIKCYGPGQPTWNTTSVFKITPKLM 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 37/76 (49%)
CG18538NP_611314.2 DUF1091 82..157 CDD:284008 36/74 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459021
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.