DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14502 and CG18536

DIOPT Version :9

Sequence 1:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_611312.1 Gene:CG18536 / 37093 FlyBaseID:FBgn0034322 Length:191 Species:Drosophila melanogaster


Alignment Length:180 Identity:90/180 - (50%)
Similarity:129/180 - (71%) Gaps:4/180 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IGGVLILLIVDQCNGKRKWDYEPLSIETYTTDETKLKIAAKVERVGRGEYALSGNIEFKYTPEDN 74
            ||.|.||..:...:  |||||||:.:...::||:|||..||:||:||.:|.||..:|:||...:.
  Fly    13 IGIVCILFHLTAAS--RKWDYEPILLTATSSDESKLKFEAKIERLGRSDYGLSAILEWKYDTNEE 75

  Fly    75 TMVEAMAYRSTSGDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGKFEPPWPQ 139
            |||||.||||.||||:|||::|::|||||:.:::|::||:|:..|||.||||.|::.||:||||:
  Fly    76 TMVEAQAYRSNSGDESDYKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSNLPKYEDKFQPPWPK 140

  Fly   140 DTYVLEKCVANSDGFPDMVPEGYYKVNFTLTNP--VDWGFILIVKITTKL 187
            :||.|:||....||.|::.|.|:||:.||...|  ..|||..:.|:|.|:
  Fly   141 NTYKLDKCKIGGDGLPEIAPPGFYKIVFTKFGPGQPTWGFTAVFKLTNKI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 40/76 (53%)
CG18536NP_611312.1 DUF1091 89..166 CDD:284008 40/76 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459023
Domainoid 1 1.000 47 1.000 Domainoid score I19153
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I7686
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008547
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.