DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14502 and CheA7a

DIOPT Version :9

Sequence 1:NP_001163192.1 Gene:CG14502 / 37092 FlyBaseID:FBgn0034321 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_572395.2 Gene:CheA7a / 31672 FlyBaseID:FBgn0029948 Length:177 Species:Drosophila melanogaster


Alignment Length:185 Identity:45/185 - (24%)
Similarity:84/185 - (45%) Gaps:27/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLILLIVDQCNGKRKWDYEPLSIETYTTDETKLKI----------AAKVERVGRGEYALSGNIEF 67
            :|.:|:|..|..::.:..|   :.|:|.|:|   |          ...:::|.|.::.:||:.||
  Fly     7 LLSILLVHSCRAEKPYSVE---LNTFTMDDT---IENQENWVDWGTLSMKKVSRNQFVVSGDFEF 65

  Fly    68 KYTPEDNTMVEAMAYRSTSGDENDYKIMPFSIPKQPYVEFMNSHYKNVVLPNLGDCSNLIKFDGK 132
            |....|...:..|.|...| :.|....|..:: |:|:.:|:.....:  .|::...|||...|  
  Fly    66 KLNMADEQKIVLMVYVYDS-NANQRGSMVMAV-KKPFCQFIKEDEDS--YPSIQKASNLPDQD-- 124

  Fly   133 FEPPWPQDTYVLEKCVANSDGFPDMVPEGYYKVNFTLTN---PVDWGFILIVKIT 184
             ..|:|:..|.::.....::..||..|:|.|.:..:|.:   ||. |.:..|.:|
  Fly   125 -TCPFPKGKYTIDNYELETNFLPDNAPKGDYLLQLSLLDREVPVA-GLVATVTLT 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14502NP_001163192.1 DUF1091 88..165 CDD:284008 18/76 (24%)
CheA7aNP_572395.2 DM8 89..177 CDD:214778 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.