DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Gyc76C

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001163473.1 Gene:Gyc76C / 8674026 FlyBaseID:FBgn0266136 Length:1525 Species:Drosophila melanogaster


Alignment Length:553 Identity:191/553 - (34%)
Similarity:274/553 - (49%) Gaps:127/553 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 RGLLHHLSEQIKETDNSGVWRYLVGFKNLLKSIECQNIATSFGIR-----------YYGRGSL-- 309
            ||.:..:.| :|......:.|.::....||:.:...||.:..|..           |..:|||  
  Fly   574 RGAVVRIKE-LKFPRKRDISREIMKEMRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYD 637

  Fly   310 TAEN--------FVSYVRYEFMAREMI---NSTLNYAPMLKNMYTNITSTKKF---------HRA 354
            ..||        |::.:.:: :.:.||   ||.|.|...||:  :|...|.::         |..
  Fly   638 IIENEDIKLDDLFIASLIHD-LIKGMIYIHNSQLVYHGNLKS--SNCVVTSRWMLQVTDFGLHEL 699

  Fly   355 KQMGTT------------------LLKNNPNVSNERS----AIEYYELMN--------NYTDDLR 389
            :|....                  ||:|:.:.|.:..    ||..||:.:        |:..   
  Fly   700 RQCAENESIGEHQHYRNQLWRAPELLRNHIHGSQKGDVYAFAIIMYEIFSRKGPFGQINFEP--- 761

  Fly   390 ILQKALRRLIKEYVDK--------------TLVEADRKEAIGIAILVVVLIVSP-------VIIV 433
                   :.|.:||.|              :::||:......:|.:.......|       ||..
  Fly   762 -------KEIVDYVKKLPLKGEDPFRPEVESIIEAESCPDYVLACIRDCWAEDPEERPEFSVIRN 819

  Fly   434 LVKNAAA------------TIQLYALNL----SQKAKELKREKRKSDSLLFQMLPPSVAMQLKQT 482
            .:|....            .::.||.||    :::.:.|..||.|::.||.:|||.|||.:|...
  Fly   820 RLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMG 884

  Fly   483 QQVPAELYEAVTIYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMV 547
            |.|....|:.||||||||||||.::|:.|||:||.|||.:|.|||..|..|||||||||||:|||
  Fly   885 QGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMV 949

  Fly   548 ASGLPVKNGNKHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCL 612
            .||||:|||::|..|||:|||:||.|....||....:|.:::|.|:||||||||:||..||||||
  Fly   950 VSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCL 1014

  Fly   613 FGDTVNTASRMESTGEAQKIHITEEMHDSLQQV-GGFRTEHRGLIDVKGKGLMSTYWLTCKDGPV 676
            |||||||||||||.|||.||||:.:...:|.:: ||:.||.|||:::||||.:.|:|||      
  Fly  1015 FGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLT------ 1073

  Fly   677 RAREEISWRADIQPVFLDHLKLHPPTDYKLPKR 709
            .|.|..     ||...:|.:.:.||. :..|::
  Fly  1074 GANENA-----IQKKLVDMMDMPPPL-FSRPRK 1100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564 38/200 (19%)
HNOBA <439..479 CDD:285003 16/55 (29%)
CYCc 459..647 CDD:214485 114/188 (61%)
Guanylate_cyc 485..669 CDD:278633 113/184 (61%)
Gyc76CNP_001163473.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 49/266 (18%)
HNOBA <835..881 CDD:285003 16/45 (36%)
CYCc 860..1052 CDD:214485 116/191 (61%)
Guanylate_cyc 887..1074 CDD:278633 116/192 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.