DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and si:dkey-37g12.1

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_021333677.1 Gene:si:dkey-37g12.1 / 796669 ZFINID:ZDB-GENE-090312-145 Length:882 Species:Danio rerio


Alignment Length:244 Identity:122/244 - (50%)
Similarity:165/244 - (67%) Gaps:4/244 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 LVKNAAATIQLYALNL----SQKAKELKREKRKSDSLLFQMLPPSVAMQLKQTQQVPAELYEAVT 494
            ::.:..:.::.||.||    |::..||:.||::::.||.||||.|||.||...:.|.||.|:.||
Zfish   638 ILDDLLSRMEQYACNLEEIVSERTAELQEEKKRAEGLLTQMLPRSVASQLIAGKTVRAETYDCVT 702

  Fly   495 IYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGLPVKNGNKH 559
            ||||||.|||.::|..||::||..||.:|..||..|:.::|||||||||:|||.||||::||:.|
Zfish   703 IYFSDIEGFTAMSASLTPMQVVNVLNDLYTYFDNIIDYHNVYKVETIGDAYMVVSGLPIRNGDDH 767

  Fly   560 ISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRME 624
            ..|||.|:|.::.....|..|...::.:::|.|||:||.|||:||.|||||||||||||||||||
Zfish   768 AKEIARMSLAIVQGLRSFHSPHVPEQQLRVRIGVHSGPCVAGVVGLKMPRYCLFGDTVNTASRME 832

  Fly   625 STGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLTCKD 673
            |.|...|||::......|.....||.|.||.|.:||||.:.|:||..:|
Zfish   833 SYGLPLKIHVSSSTKSLLDTFRNFRCELRGDIHIKGKGWVRTFWLLGED 881

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 18/43 (42%)
CYCc 459..647 CDD:214485 101/187 (54%)
Guanylate_cyc 485..669 CDD:278633 99/183 (54%)
si:dkey-37g12.1XP_021333677.1 Periplasmic_Binding_Protein_Type_1 <59..258 CDD:324556
PKc_like 355..628 CDD:328722
HNOBA <641..687 CDD:311573 18/45 (40%)
CYCc 666..850 CDD:214485 100/183 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.