DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and adcy1b

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001161822.1 Gene:adcy1b / 569499 ZFINID:ZDB-GENE-100805-1 Length:1114 Species:Danio rerio


Alignment Length:326 Identity:102/326 - (31%)
Similarity:169/326 - (51%) Gaps:40/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 LRI--LQKALRRLIKEYVDKTLVE-ADRKEAIGIAILVVVLIVSPVIIVLVKNAAATIQ------ 443
            ||:  :.|.:..|:...:..|::| :..:.|.|.|:| .|..:.|::.:|:.:.|..:.      
Zfish   724 LRVSWIPKTILLLLLLVLYITILELSGFRRASGWALL-SVRGLEPLLSLLLFSTAVALHSRQLDL 787

  Fly   444 ------LYALNLSQKAKELKREKRKSDSLLFQMLPPSVAMQL----KQTQQVPAELYEAVTIYFS 498
                  |:|....::...:::.|..:..:||.:||..||...    .:...:..:.|..|.:.|:
Zfish   788 KLRLDFLWATQAEEERDGMEKVKLDNKRILFNLLPVHVAQHFLLSNPRNMDLYYQSYAQVGVLFA 852

  Fly   499 DIVGFT----EIAADCTPLEVVTFLNSIYRVFDERI--ECY-DVYKVETIGDSYMVASGLPVKNG 556
            .|..|.    |:..:...:|.:..||.|...|||.:  ||| |:.|::|||.:||.|.||....|
Zfish   853 SIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKECYKDIEKIKTIGSTYMSAVGLVPTIG 917

  Fly   557 NK-------HISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFG 614
            .|       |:|.||..|:::.|....... ::.::|| :|.|::.||||||::|.:.|:|.::|
Zfish   918 TKAKKSTATHLSTIADFAIEMFDVLDEINY-QSYNDFV-LRVGINVGPVVAGVIGARRPQYDIWG 980

  Fly   615 DTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLTCK--DGPVR 677
            :|||.||||:|||...||.:||:::..||  ..:....||.:.|||||.|.||:|..|  |..:|
Zfish   981 NTVNVASRMDSTGVPGKIQVTEDVYRLLQ--NNYDLMCRGNVSVKGKGQMLTYFLEGKAQDPGIR 1043

  Fly   678 A 678
            |
Zfish  1044 A 1044

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564 3/9 (33%)
HNOBA <439..479 CDD:285003 10/51 (20%)
CYCc 459..647 CDD:214485 71/205 (35%)
Guanylate_cyc 485..669 CDD:278633 74/197 (38%)
adcy1bNP_001161822.1 AC_N <128..270 CDD:292831
CYCc 236..431 CDD:214485
Guanylate_cyc 272..454 CDD:278633
DUF1053 498..585 CDD:283888
CYCc 806..1012 CDD:214485 71/209 (34%)
Guanylate_cyc 839..1035 CDD:278633 75/199 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.