DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and npr3

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:248 Identity:56/248 - (22%)
Similarity:102/248 - (41%) Gaps:56/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 FTNGSKQRANLT------LRFANTDHALNNMTTWSEISVPTA---PDEDEDDRE---------MM 220
            |.:.:.:.::||      |:.|.|..|:.....|.     ||   .|:|:|:|.         .:
Zfish   131 FNSKTPEYSHLTRIAPTYLKMAETFQAIFGHFGWR-----TAYLIYDDDKDERNCYFTMEGVFTV 190

  Fly   221 LNRYEFQSR---LNEFRDRVRLEPEESSITEVMNWYTSINRGLLHHLSEQIKETDNSGVWRYLVG 282
            |:.|...:.   ||...:||  :| :..||.|......|    :...::.:::...:...|.|..
Zfish   191 LSEYHISTDFAVLNSNEERV--DP-DGIITSVYGSEVVI----MCSKADIVRDLMLAAHRRKLTS 248

  Fly   283 FKNLLKSIECQNIATSFGIRYYGRGSLTAENFVSYVRYEFMAREMINSTLNYAPMLKNMYTNITS 347
            ..::..:||..|.::      ||.||....:     :|:..||... |.||...:|:       |
Zfish   249 DSHIFFNIELFNSSS------YGDGSWRRRD-----KYDDEARAAY-SFLNTVTLLR-------S 294

  Fly   348 TK-KFHR-AKQMGTTLLKNNPNVSNERSAIEYYELMNNYTDDLRILQKALRRL 398
            || :|.. :.:|..:|.::|..:..:.||:..:  |..:.|.|.:...|||.:
Zfish   295 TKPEFEDFSIEMKKSLQQSNIPICEDCSAVNMF--MEGFHDALLLYAIALREV 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564 54/244 (22%)
HNOBA <439..479 CDD:285003
CYCc 459..647 CDD:214485
Guanylate_cyc 485..669 CDD:278633
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 56/248 (23%)
ANF_receptor 46..389 CDD:279440 56/248 (23%)
TM_EphA1 436..468 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.