DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and adcy6b

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_002666536.2 Gene:adcy6b / 560807 ZFINID:ZDB-GENE-090127-2 Length:1174 Species:Danio rerio


Alignment Length:290 Identity:98/290 - (33%)
Similarity:159/290 - (54%) Gaps:21/290 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 YVDKTLVEADRKEAIGIAILVVVLIVSPVIIVLVKNAAATIQLYALNLSQKAKELKREKRKSDSL 466
            |..:|:.:...:.:|.: ||.|.::...:....|::.|....|:.|..:::.:|::..:..:..|
Zfish   889 YCQETVTKVSLRVSIPV-ILTVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRL 952

  Fly   467 LFQMLPPSVAMQLKQTQQVPAELY----EAVTIYFSDIVGF----TEIAADCTPLEVVTFLNSIY 523
            |..:||..||......::...|||    |.|.:.|:.|..|    ||:.|:...:|.:..||.|.
Zfish   953 LHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASISNFSEFYTELEANNEGVECLRLLNEII 1017

  Fly   524 RVFDERI--ECY-DVYKVETIGDSYMVASGLP----VKNGNKHISEIATMALDLLDASSVFRIPR 581
            ..|||.|  |.| .:.|::|||.:||.||||.    .|.|..||..:|..|:.|.:...... ..
Zfish  1018 ADFDEIISEEKYKQLEKIKTIGSTYMAASGLNDSTYDKEGRTHILALADYAMRLREQMKYIN-EH 1081

  Fly   582 AGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVG 646
            :.:.| |::.|::.||||||::|.:.|:|.::|:|||.||||:|||...:|.:|.:::..|:. .
Zfish  1082 SFNNF-QMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVTTDLYHVLES-K 1144

  Fly   647 GFRTEHRGLIDVKGKGLMSTYWLTCKDGPV 676
            |::.|.|||:.|||||.|:||:|  ..|||
Zfish  1145 GYQLECRGLVKVKGKGDMTTYFL--NSGPV 1172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 10/39 (26%)
CYCc 459..647 CDD:214485 70/202 (35%)
Guanylate_cyc 485..669 CDD:278633 77/198 (39%)
adcy6bXP_002666536.2 AC_N 15..376 CDD:318454
Guanylate_cyc 378..562 CDD:306677
DUF1053 590..677 CDD:310728
Guanylate_cyc 975..1169 CDD:306677 77/198 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.