DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and si:dkey-206f10.1

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_009293230.1 Gene:si:dkey-206f10.1 / 560719 ZFINID:ZDB-GENE-041014-154 Length:1187 Species:Danio rerio


Alignment Length:284 Identity:93/284 - (32%)
Similarity:149/284 - (52%) Gaps:36/284 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 GIAILVVVLIVSPVIIVLV--KNAAATIQ---LYALNLSQKAKELKREKRKSDSLLFQMLPPSVA 476
            |::||::.:.   :|.||.  :...||.:   |:.|...|:.:|::..:..::.||..:||..||
Zfish   854 GVSILLMAMF---MIAVLYNGRRWEATTRLDFLWRLQAQQEVQEMRDLREHNECLLHNILPAHVA 915

  Fly   477 MQL----KQTQQVPAELYEAVTIYFSDIVGFT------EIAADCTPLEVVTFLNSIYRVFDERIE 531
            ...    :..|::.::.|:.|.:.|:.|.||.      ||..:  .:|.:..||.|...|||.:|
Zfish   916 RHFLERNRNDQELYSQSYDEVGVMFASIAGFNDYYEQKEIKHE--GVECLKLLNEIIADFDELLE 978

  Fly   532 ---CYDVYKVETIGDSYMVASGLP------VKNGNKHISEIATMALDLLDASSVFRIPRAGDEFV 587
               ..|:.|::|||..||.||||.      |.|...|:||:...||.:.:  ::..|.:......
Zfish   979 ESYFLDIEKIKTIGSCYMAASGLSPDKQSRVVNDWHHLSELVLFALAMQE--TLREINKHSMNNF 1041

  Fly   588 QIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEH 652
            |:|.|:..||||||::|...|:|.::|.|||.||||:|||.:.:|.:.|...:.|.. .||..|.
Zfish  1042 QLRVGIAHGPVVAGVIGATKPQYDIWGMTVNLASRMDSTGVSGRIQVPEATRNILAD-WGFVLEL 1105

  Fly   653 RGLIDVKG----KGLMSTYWLTCK 672
            ||.|.:||    ||.:.||:::.|
Zfish  1106 RGEIYIKGVSERKGRVRTYFISTK 1129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 12/42 (29%)
CYCc 459..647 CDD:214485 68/206 (33%)
Guanylate_cyc 485..669 CDD:278633 73/202 (36%)
si:dkey-206f10.1XP_009293230.1 AC_N <135..380 CDD:292831
CYCc 343..538 CDD:214485
Guanylate_cyc 382..564 CDD:278633
DUF1053 <611..661 CDD:283888
CYCc 899..1097 CDD:214485 67/201 (33%)
Guanylate_cyc 928..1126 CDD:278633 73/202 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.