DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Adcy4

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_062158.2 Gene:Adcy4 / 54223 RGDID:2034 Length:1072 Species:Rattus norvegicus


Alignment Length:244 Identity:83/244 - (34%)
Similarity:131/244 - (53%) Gaps:31/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 KELKREKRKSDS-------LLFQMLPPSVAMQL----KQTQQVPAELYEAVTIYFSDIVGFTEIA 507
            |:|::|:.::::       ||..:||..||.|.    ::.:.:..:.||.|.:.|:.|..|.|..
  Rat   819 KKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASIPDFKEFY 883

  Fly   508 ADCT----PLEVVTFLNSIYRVFDERI---ECYDVYKVETIGDSYMVASGLPVKNGN-------- 557
            ::..    .||.:..||.|...|||.:   :...|.|::|||.:||.|:||....|.        
  Rat   884 SESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATPGQDTQQDAER 948

  Fly   558 --KHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTA 620
              .|:..:...|:.|  .|.:..|.:......::|.|::.||||||::|.:.|:|.::|:|||.|
  Rat   949 SCSHLGTMVEFAVAL--GSKLGVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVA 1011

  Fly   621 SRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWL 669
            |||||||...||.:|||...:||.: |:....||:|.|||||.:.||:|
  Rat  1012 SRMESTGVLGKIQVTEETARALQSL-GYTCYSRGVIKVKGKGQLCTYFL 1059

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 9/31 (29%)
CYCc 459..647 CDD:214485 69/215 (32%)
Guanylate_cyc 485..669 CDD:278633 72/200 (36%)
Adcy4NP_062158.2 AC_N <115..246 CDD:292831
CYCc 219..422 CDD:214485
Guanylate_cyc 264..430 CDD:278633
DUF1053 479..580 CDD:283888
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 498..523
CYCc 824..1039 CDD:214485 70/217 (32%)
Guanylate_cyc 861..1060 CDD:278633 73/202 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.