DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33958 and NPR3

DIOPT Version :9

Sequence 1:	NP_001033958.1	Gene:	CG33958 / 37088	FlyBaseID:	FBgn0053958	Length:	710	Species:	Drosophila melanogaster
Sequence 2:	NP_001191304.1	Gene:	NPR3 / 4883	HGNCID:	7945	Length:	541	Species:	Homo sapiens

Alignment Length:	133	Identity:	31/133 - (23%)
Similarity:	54/133 - (40%)	Gaps:	20/133 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   527 DERIE--CYDVYKVETIGDSYMVASGLPVKNGNKHISEIATMALDLLDASSVFRIPRAGDEFVQI 589
            |:::|  ||  :.:|.:.:.:. ..||       |.|..:......||...:.|..:|.:..| |
Human   206 DDKLERNCY--FTLEGVHEVFQ-EEGL-------HTSIYSFDETKDLDLEDIVRNIQASERVV-I 259

  Fly   590 RCG----VHTGPVVAGIVGTKMPRYCLFG-DTVNTASRMESTGEAQKIHITE--EMHDSLQQVGG 647
            .|.    :.:..:||...|.....|..|. :..|::|..:.:.:....|..|  :.:.|||.|..
Human   260 MCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTL 324

  Fly   648 FRT 650
            .||
Human   325 LRT 327

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33958	NP_001033958.1	NIT	159..396	CDD:285564
		HNOBA	<439..479	CDD:285003
		CYCc	459..647	CDD:214485	29/128 (23%)
		Guanylate_cyc	485..669	CDD:278633	31/133 (23%)
NPR3	NP_001191304.1	PBP1_NPR_C_like	54..446	CDD:107381	31/133 (23%)
		ANF_receptor	71..422	CDD:279440	31/133 (23%)
		TM_EphA1	476..507	CDD:214014
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900