DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Ac76E

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001246838.1 Gene:Ac76E / 40180 FlyBaseID:FBgn0004852 Length:1312 Species:Drosophila melanogaster


Alignment Length:306 Identity:87/306 - (28%)
Similarity:147/306 - (48%) Gaps:35/306 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 LIKEYVDKTLVEADRKEAIGIAILVVVLIVSPVIIVLVKNAAATIQLYALNLSQKAKELKREKRK 462
            |.:.|.|..:......|..|..:|:|:::|...:....:..|.|..|:...|..:.:|::..:..
  Fly  1011 LFEMYNDANITHGLPLEIKGFLLLLVIILVLHTLDRQGEYVARTDFLWKAKLKVEQEEVETMRGI 1075

  Fly   463 SDSLLFQMLPPSVA---MQLKQTQQVPAELYEAVTIYFSDIVGFTEIAADC----TPLEVVTFLN 520
            :..||..:||..||   :.|:::.::..|.|..|.:.|:.|..:.|...:.    ..||.:..||
  Fly  1076 NKILLENILPAHVATHFLHLERSTELYHESYSCVAVMFASIPNYKEFYDETDVNKQGLECLRLLN 1140

  Fly   521 SIYRVFDERI---ECYDVYKVETIGDSYMVASGL--------------PVKNGNKH----ISEIA 564
            .|...||:.:   :...:.|::||..:||.||||              ..|...:|    :.|.|
  Fly  1141 EIICDFDKLLLKPKFSGIEKIKTIASTYMCASGLRPGKEDGATSRSFADEKRTEEHNVVILVEFA 1205

  Fly   565 TMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEA 629
            ...:.:||:     |.|...:..::|.|::.|||:||::|.:.|:|.::.:|||.||||:|.|..
  Fly  1206 IALMSILDS-----INRESFQRFRLRIGLNHGPVIAGVIGAQKPQYDIWSNTVNVASRMDSCGVM 1265

  Fly   630 QKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWL-TCKDG 674
            .::..||.....| ...|:..|.|||..|||||.:.||:: |..||
  Fly  1266 GRLQTTENTAKIL-MTAGYECECRGLTYVKGKGNLVTYFVKTPFDG 1310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 11/42 (26%)
CYCc 459..647 CDD:214485 59/215 (27%)
Guanylate_cyc 485..669 CDD:278633 64/208 (31%)
Ac76ENP_001246838.1 AC_N <67..289 CDD:292831
CYCc 259..467 CDD:214485
Guanylate_cyc 311..469 CDD:278633
BASP1 510..667 CDD:283191
CYCc 1079..1283 CDD:214485 59/209 (28%)
Guanylate_cyc 1101..1305 CDD:278633 64/209 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.