DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and rut

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_511156.2 Gene:rut / 32406 FlyBaseID:FBgn0003301 Length:2248 Species:Drosophila melanogaster


Alignment Length:466 Identity:124/466 - (26%)
Similarity:197/466 - (42%) Gaps:103/466 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 NIATSFGIRYYGRGSLTAENFVSYVRYEFMAREMINSTLNYAPMLKNMYTNITSTKKFHRAKQMG 358
            :|:.||.:|                    ||..:....|.|:....|::|.::.    |.....|
  Fly   761 DISESFSLR--------------------MAITIFTVILIYSVGQVNVFTCVSD----HPCSGNG 801

  Fly   359 TTLLKNNPNVSNERSAIEYYELMN------NYTDDLR--ILQKALRRL----------------I 399
            ||..:|:   |:.:.::..|..::      :.:..||  |:.|:|..|                |
  Fly   802 TTSFQND---SHRKCSLPQYVSLSAAFAFLSVSVFLRLPIIFKSLLVLGMGTIYGLFIELSHQNI 863

  Fly   400 KEYVDKTLVEADRKEAIGIAILVVVLIVSPVIIVLVKNAAATIQLYALNLSQKAKELKREKRKSD 464
            .|..|..:..:.....|.:|.:.:.:|...|...||:..|....|:.|..||:.||:...:..:.
  Fly   864 FECYDNRVNASIPLHLISLARIAIFMIAILVHGRLVEGTARLDFLWQLQASQEKKEMDVLQESNK 928

  Fly   465 SLLFQMLPPSVA-----MQLKQTQQVPAELYEAVTIYFSDIVGF----TEIAADCTPLEVVTFLN 520
            .:|..:||..||     .|.:...::..:.|..|.:.|:.:..|    ||:......||.:..||
  Fly   929 RILHNLLPAHVAAHFLDAQFRNNMELYHQSYAKVGVIFASVPNFNEFYTEMDGSDQGLECLRLLN 993

  Fly   521 SIYRVFDERIE---CYDVYKVETIGDSYMVASGLPVKNGNKHISEIATMALDLLDASSVFRIPRA 582
            .|...|||.::   ...:.|::|:|.:||...||           |....:...|.:||.|...|
  Fly   994 EIIADFDELLKEDRFRGIDKIKTVGSTYMAVVGL-----------IPEYKIQPNDPNSVRRHMTA 1047

  Fly   583 GDEFVQ------------------IRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEA 629
            ..|:|:                  :|.|::.||||||::|.:.|:|.::|:|||.||||:|||..
  Fly  1048 LIEYVKAMRHSLQEINSHSYNNFMLRVGINIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVP 1112

  Fly   630 QKIHITEEMHDSLQQVGG-FRTEHRGLIDVKGKGLMSTYWLTCKDGPVRAREEISWRADIQPVFL 693
            ....:|:|:.|||  ||. |....||.|.|||||.|.||:| |..|      ..|...:::....
  Fly  1113 GYSQVTQEVVDSL--VGSHFEFRCRGTIKVKGKGDMVTYFL-CDSG------NKSLNGEVRNAMS 1168

  Fly   694 DHLKLHPPTDY 704
            ....||.| ||
  Fly  1169 LPQSLHAP-DY 1178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564 21/109 (19%)
HNOBA <439..479 CDD:285003 12/44 (27%)
CYCc 459..647 CDD:214485 63/217 (29%)
Guanylate_cyc 485..669 CDD:278633 70/209 (33%)
rutNP_511156.2 AC_N <17..255 CDD:292831
CYCc 230..425 CDD:214485
Guanylate_cyc 266..438 CDD:278633
DUF1053 624..696 CDD:283888
SLC5-6-like_sbd <742..>893 CDD:294310 29/158 (18%)
CYCc 924..1134 CDD:214485 65/222 (29%)
Guanylate_cyc 954..1151 CDD:278633 70/209 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.