DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and CG32305

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster


Alignment Length:330 Identity:89/330 - (26%)
Similarity:132/330 - (40%) Gaps:86/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   451 QKAKELKREKRKSDSLLF-QMLPPSVAMQLKQTQ---QVPAELYEAVTIYFSDIVGFTEIAADCT 511
            ::|.:...||.:|..::. .:||..||...|..:   |:..|.:..|.:.|:.|..|.   ||..
  Fly   807 EEAHQQTDEKLRSIKIIMANILPTHVAQVYKVRRPHDQLYYENFSKVAVMFASIENFN---ADTA 868

  Fly   512 PLEVVTFLNSIYRVFDERIECYDV-YKVETI---GDSYMVASGL------------PVK------ 554
            .|.:   |:.|...||:.:..|.. ||:|.|   |.:||||.||            |||      
  Fly   869 GLRI---LHEIICCFDDLLVDYQTRYKIEKIKVMGWTYMVACGLETDHYTDFSIDIPVKQPEADS 930

  Fly   555 ---------------------NGNK------HISEIATM-----ALDLLDASSVFRIPRAGDEF- 586
                                 :|:.      .:.::|.:     |||||......|......|: 
  Fly   931 EIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVLVMTEFALDLLRIMHDIRYNYVFSEYD 995

  Fly   587 ----VQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGG 647
                ..::.|:..|.|:||:||...|.|.::|.|||.||||.|||....|.:|......|:|. .
  Fly   996 TFLTGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMSSTGLLDNIQVTRHTAKVLRQF-N 1059

  Fly   648 FRTEHRGLIDVKGKGLMSTYW------LTCKDG---PVRAREEISWRADIQPVFLDHLKLHPPTD 703
            .|..:||..:|||.|.:.||.      ||.:|.   .:..::..||       .:|.|.|.....
  Fly  1060 IRCNYRGHTEVKGVGKVPTYLVVVDPDLTFQDHDQVSMSMKDSKSW-------VIDTLSLSFTPS 1117

  Fly   704 YKLPK 708
            :..||
  Fly  1118 FVPPK 1122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 8/28 (29%)
CYCc 459..647 CDD:214485 69/250 (28%)
Guanylate_cyc 485..669 CDD:278633 69/248 (28%)
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 67/247 (27%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 69/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.