DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Npr3

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:286 Identity:53/286 - (18%)
Similarity:96/286 - (33%) Gaps:110/286 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 FQSRLNEFRDRVRLEPEESSITEVM-----------------------NWYTSI--------NRG 259
            ||.:..|:....|:.|..:.:.|:|                       |.|.::        ..|
  Rat   275 FQHKDTEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALLYSDDKLERNCYFTLEGVHEVFQEEG 339

  Fly   260 LLHHLS----EQIKETDNSGVWRYLVGFKNLLKSIECQNIAT----------------------- 297
            |  |.|    ::.|:.|...:.||:.|.:.::  |.|.:..|                       
  Rat   340 L--HTSAYNFDETKDLDLDDIVRYIQGSERVV--IMCASGDTIRRIMLAVHRHGMTSGDYAFFNI 400

  Fly   298 -SFGIRYYGRGSLTAENFVSYVRYEFMAREMINSTLNYAPMLKNMYTNITSTKKFHR-AKQMGTT 360
             .|....||.||....:     :::|.|::.. |:|....:|:      |:..:|.: :.::.::
  Rat   401 ELFNSSSYGDGSWKRGD-----KHDFEAKQAY-SSLQTVTLLR------TAKPEFEKFSMEVKSS 453

  Fly   361 LLKNNPN--------VSNERSAIEYY------ELMNNYT--DDLRILQKALRRLIK--------- 400
            :.|...|        |.....||..|      .|...|:  |..:|:|:...|..:         
  Rat   454 VEKQGLNEEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSID 518

  Fly   401 ----EYVDKTLV-----EADRKEAIG 417
                .|.|.::|     ||..:|.||
  Rat   519 ANGDRYGDFSVVAMTDTEAGTQEVIG 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564 44/245 (18%)
HNOBA <439..479 CDD:285003
CYCc 459..647 CDD:214485
Guanylate_cyc 485..669 CDD:278633
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381 53/286 (19%)
ANF_receptor 182..535 CDD:279440 48/275 (17%)
TM_EphA1 587..618 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.