Sequence 1: | NP_001033958.1 | Gene: | CG33958 / 37088 | FlyBaseID: | FBgn0053958 | Length: | 710 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006232107.1 | Gene: | Npr3 / 25339 | RGDID: | 3196 | Length: | 652 | Species: | Rattus norvegicus |
Alignment Length: | 286 | Identity: | 53/286 - (18%) |
---|---|---|---|
Similarity: | 96/286 - (33%) | Gaps: | 110/286 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 FQSRLNEFRDRVRLEPEESSITEVM-----------------------NWYTSI--------NRG 259
Fly 260 LLHHLS----EQIKETDNSGVWRYLVGFKNLLKSIECQNIAT----------------------- 297
Fly 298 -SFGIRYYGRGSLTAENFVSYVRYEFMAREMINSTLNYAPMLKNMYTNITSTKKFHR-AKQMGTT 360
Fly 361 LLKNNPN--------VSNERSAIEYY------ELMNNYT--DDLRILQKALRRLIK--------- 400
Fly 401 ----EYVDKTLV-----EADRKEAIG 417 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG33958 | NP_001033958.1 | NIT | 159..396 | CDD:285564 | 44/245 (18%) |
HNOBA | <439..479 | CDD:285003 | |||
CYCc | 459..647 | CDD:214485 | |||
Guanylate_cyc | 485..669 | CDD:278633 | |||
Npr3 | XP_006232107.1 | PBP1_NPR_C_like | 165..556 | CDD:107381 | 53/286 (19%) |
ANF_receptor | 182..535 | CDD:279440 | 48/275 (17%) | ||
TM_EphA1 | 587..618 | CDD:214014 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |