DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Gucy1b2

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001257640.1 Gene:Gucy1b2 / 25206 RGDID:2770 Length:742 Species:Rattus norvegicus


Alignment Length:378 Identity:140/378 - (37%)
Similarity:202/378 - (53%) Gaps:71/378 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 FH-------RAKQMGTTLLKNNPNVSNERSAI-EYYELMN-NYTDDLRILQKALRRLIKEYVDKT 406
            ||       |.||.|..:.|..|.:..::.|: ||:.::: ..|.::..:.|.:.   .::|.||
  Rat   275 FHIVFDEALRVKQAGVNIQKYVPGILTQKFALDEYFSIIHPQVTFNISSICKFIN---SQFVLKT 336

  Fly   407 LVEADRKEAIGIA------------------ILVVVLIVSPV----------------------- 430
                 |||.:..|                  :..::.:.||.                       
  Rat   337 -----RKEMMPKARKSQPMLKLRGQMIWMESLRCMIFMCSPKLRSLQELEESKMHLSDIAPHDTT 396

  Fly   431 --IIVLVKNAAATIQLYALNLSQKAKELK-------REKRKSDSLLFQMLPPSVAMQLKQTQQVP 486
              :|:|.:...|.::| :..|.:|.:||:       .||:|:::||:.|||..||.|||:.::|.
  Rat   397 RDLILLNQQRLAEMEL-SCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGRKVA 460

  Fly   487 AELYEAVTIYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGL 551
            |..:|..||.|||:|.||.|.|.|.|:::|..|||:|..||.....:||||||||||:|||..|:
  Rat   461 AGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTSVHDVYKVETIGDAYMVVGGV 525

  Fly   552 PVKNGNKHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDT 616
            ||. ...|...:|..||.:..::.....|..| |.:|||.|:|||||:||:||.|||||||||||
  Rat   526 PVP-VESHAQRVANFALGMRISAKEVMNPVTG-EPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDT 588

  Fly   617 VNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWL 669
            |||||||||.|...|:|::...|.:|:. .||....||.|:|||||.|:||:|
  Rat   589 VNTASRMESHGLPSKVHLSPTAHRALKN-KGFEIVRRGEIEVKGKGKMTTYFL 640

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564 13/53 (25%)
HNOBA <439..479 CDD:285003 16/46 (35%)
CYCc 459..647 CDD:214485 96/187 (51%)
Guanylate_cyc 485..669 CDD:278633 96/183 (52%)
Gucy1b2NP_001257640.1 HNOB 2..163 CDD:285002
HNOBA 267..453 CDD:285003 40/186 (22%)
CYCc 432..622 CDD:214485 98/192 (51%)
Guanylate_cyc 459..642 CDD:278633 97/185 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D531253at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.