DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Gucy2g

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_620611.2 Gene:Gucy2g / 245708 RGDID:621853 Length:1103 Species:Rattus norvegicus


Alignment Length:276 Identity:129/276 - (46%)
Similarity:178/276 - (64%) Gaps:20/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   403 VDKTLVEADRKEAIGIAILVVVLIVSPVIIVLVKNAAATIQLYALNLSQKAKE----LKREKRKS 463
            :.|||.||..:..:.|                :.:....:::||.:|.:..:|    |..||||.
  Rat   825 IKKTLREASPRGRVSI----------------LDSMMGKLEMYASHLEEVVEERTCQLVAEKRKV 873

  Fly   464 DSLLFQMLPPSVAMQLKQTQQVPAELYEAVTIYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDE 528
            :.||..|||..|..||...:.|..|.:|:|||:||||||||::.:..:||:||..||.:|.:||.
  Rat   874 EKLLSTMLPSFVGEQLIAGKSVEPEHFESVTIFFSDIVGFTKLCSLSSPLQVVKLLNDLYSLFDH 938

  Fly   529 RIECYDVYKVETIGDSYMVASGLPVKNGNKHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGV 593
            .|:.:||||||||||:||||||||::||.:|..|||||:|.||..::.|:|....:|.:::|.|:
  Rat   939 TIQTHDVYKVETIGDAYMVASGLPIRNGAQHADEIATMSLHLLSVTTNFQIGHMPEERLKLRIGL 1003

  Fly   594 HTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDV 658
            ||||||||:||..||||||||||||.||||||:....:||:::....:|...||:..:.||.|.|
  Rat  1004 HTGPVVAGVVGITMPRYCLFGDTVNMASRMESSSLPLRIHVSQSTARALLVAGGYHLQKRGTISV 1068

  Fly   659 KGKGLMSTYWLTCKDG 674
            ||||..:|:|||.|||
  Rat  1069 KGKGEQTTFWLTGKDG 1084

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 15/43 (35%)
CYCc 459..647 CDD:214485 101/187 (54%)
Guanylate_cyc 485..669 CDD:278633 100/183 (55%)
Gucy2gNP_620611.2 PBP1_GC_G_like 50..439 CDD:107367
ANF_receptor 66..417 CDD:279440
PK_GC 558..832 CDD:270894 3/6 (50%)
CYCc 868..1058 CDD:214485 102/189 (54%)
Guanylate_cyc 895..1081 CDD:278633 102/185 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11920
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.