DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Gucy1b2

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:XP_011243363.2 Gene:Gucy1b2 / 239134 MGIID:2660873 Length:829 Species:Mus musculus


Alignment Length:378 Identity:138/378 - (36%)
Similarity:201/378 - (53%) Gaps:71/378 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 FH-------RAKQMGTTLLKNNPNVSNERSAI-EYYELMN-NYTDDLRILQKALRRLIKEYVDKT 406
            ||       |.||.|..:.|..|.:..::..: ||:.::: ..|.::..:.|.:.   .:::.||
Mouse   388 FHVVFDEALRVKQAGVNIQKYVPGILTQKFGLDEYFSIVHPQVTFNISSICKFIN---SQFILKT 449

  Fly   407 LVEADRKEAIGIA------------------ILVVVLIVSPV----------------------- 430
                 |:|.:..|                  :..:|.:.||.                       
Mouse   450 -----RREMMPEAWKSQPTLKLRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTT 509

  Fly   431 --IIVLVKNAAATIQLYALNLSQKAKELK-------REKRKSDSLLFQMLPPSVAMQLKQTQQVP 486
              :|:|.:...|.::| :..|.:|.:||:       .||:|:::||:.|||..||.|||:.::|.
Mouse   510 RDLILLNQQRLAEMEL-SCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEGKKVA 573

  Fly   487 AELYEAVTIYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGL 551
            |..:|..||.|||:|.||.|.|.|.|:::|..|||:|..||.....:||||||||||:|||..|:
Mouse   574 AGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGV 638

  Fly   552 PVKNGNKHISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDT 616
            ||. ...|...:|..||.:..::.....|..| |.:|||.|:|||||:||:||.|||||||||||
Mouse   639 PVP-VESHAQRVANFALGMRISAKEVMNPVTG-EPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDT 701

  Fly   617 VNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWL 669
            |||||||||.|...|:|::...|.:|:. .||....||.|:|||||.|:||:|
Mouse   702 VNTASRMESHGLPNKVHLSPTAHRALEN-KGFEIVTRGEIEVKGKGKMTTYFL 753

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564 12/53 (23%)
HNOBA <439..479 CDD:285003 16/46 (35%)
CYCc 459..647 CDD:214485 96/187 (51%)
Guanylate_cyc 485..669 CDD:278633 96/183 (52%)
Gucy1b2XP_011243363.2 HNOB 115..276 CDD:400167
HNOBA 380..566 CDD:400168 38/186 (20%)
Guanylate_cyc 572..754 CDD:306677 97/185 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D531253at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.