DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and ADCY4

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_001185497.1 Gene:ADCY4 / 196883 HGNCID:235 Length:1077 Species:Homo sapiens


Alignment Length:264 Identity:88/264 - (33%)
Similarity:138/264 - (52%) Gaps:50/264 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   454 KELKREKRKSDS-------LLFQMLPPSVAMQL----KQTQQVPAELYEAVTIYFSDIVGFTEIA 507
            |:|::|:.::::       ||..:||..||.|.    ::.:.:..:.||.|.:.|:.:..|.|..
Human   822 KKLRQEREETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFY 886

  Fly   508 ADCT----PLEVVTFLNSIYRVFDERI---ECYDVYKVETIGDSYMVASGLPVKNG-------NK 558
            ::..    .||.:..||.|...|||.:   :...|.|::|||.:||.|:||...:|       .:
Human   887 SESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAER 951

  Fly   559 HISEIATMA---------LDLLDASSV--FRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCL 612
            ..|.:.||.         ||:::..|.  ||          :|.|::.||||||::|.:.|:|.:
Human   952 SCSHLGTMVEFAVALGSKLDVINKHSFNNFR----------LRVGLNHGPVVAGVIGAQKPQYDI 1006

  Fly   613 FGDTVNTASRMESTGEAQKIHITEEMHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLT---CKDG 674
            :|:|||.||||||||...||.:|||...:||.: |:....||:|.|||||.:.||:|.   .:.|
Human  1007 WGNTVNVASRMESTGVLGKIQVTEETAWALQSL-GYTCYSRGVIKVKGKGQLCTYFLNTDLTRTG 1070

  Fly   675 PVRA 678
            |..|
Human  1071 PPSA 1074

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 9/31 (29%)
CYCc 459..647 CDD:214485 71/223 (32%)
Guanylate_cyc 485..669 CDD:278633 74/208 (36%)
ADCY4NP_001185497.1 AC_N <115..246 CDD:292831
CYCc 219..422 CDD:214485
Guanylate_cyc 264..418 CDD:278633
DUF1053 479..583 CDD:283888
CYCc 827..1042 CDD:214485 72/225 (32%)
Guanylate_cyc 864..1063 CDD:278633 74/209 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.