DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and gcy-9

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_509897.3 Gene:gcy-9 / 191645 WormBaseID:WBGene00001536 Length:1081 Species:Caenorhabditis elegans


Alignment Length:249 Identity:114/249 - (45%)
Similarity:152/249 - (61%) Gaps:11/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   434 LVKNAAATIQLYALNLSQKAKE----LKREKRKSDSLLFQMLPPSVAMQLKQTQQVPAELYEAVT 494
            ||......::.|..||....::    |:..::::|.||..|||.|:|..||..:.|..:||...|
 Worm   834 LVDQMMKMMEEYTANLENMVRDRTALLEEAQKQADRLLNSMLPKSIAEDLKIGKPVLPQLYSCAT 898

  Fly   495 IYFSDIVGFTEIAADCTPLEVVTFLNSIYRVFDERIECYDVYKVETIGDSYMVASGLPVKNGNKH 559
            :.||||.|||.|::..|||:||||||.::..||..|..:|.||||||||:||:.||:|.:|||.|
 Worm   899 VLFSDIRGFTRISSTSTPLQVVTFLNDMFSGFDAIIAKHDAYKVETIGDAYMIVSGVPTENGNSH 963

  Fly   560 ISEIATMALDLLDASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRME 624
            ...||.:||.:......|::....:|.:.:|.|.|:|||.||:||...|||||||||||||||||
 Worm   964 AQNIADVALKMRAFICNFKLAHRPEELMMVRIGFHSGPVAAGVVGLAAPRYCLFGDTVNTASRME 1028

  Fly   625 STGEAQKIHITEE----MHDSLQQVGGFRTEHRGLIDVKGKGLMSTYWLTCKDG 674
            |||.|.||.|:|.    :|....|   |:...||.|:|||||...||:|..:.|
 Worm  1029 STGVANKIQISEGAYNLLHCFFPQ---FQMVERGKIEVKGKGECLTYYLEGRTG 1079

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 12/43 (28%)
CYCc 459..647 CDD:214485 95/191 (50%)
Guanylate_cyc 485..669 CDD:278633 96/187 (51%)
gcy-9NP_509897.3 Periplasmic_Binding_Protein_Type_1 66..416 CDD:299141
ANF_receptor 69..404 CDD:279440
PKc_like 550..820 CDD:304357
HNOBA <837..883 CDD:285003 12/45 (27%)
CYCc 862..1054 CDD:214485 95/194 (49%)
Guanylate_cyc 889..1076 CDD:278633 97/189 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11920
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.