DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and acy-2

DIOPT Version :9

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_504553.1 Gene:acy-2 / 191607 WormBaseID:WBGene00000069 Length:1080 Species:Caenorhabditis elegans


Alignment Length:292 Identity:83/292 - (28%)
Similarity:142/292 - (48%) Gaps:48/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 AIGIAILVVVLIVSPVIIVLVKNAAATIQLYALNLSQKAKELKREKRKSDSLLFQMLPPSVAMQL 479
            :|.:::|||:|.....|....:...:...   ::...:.::::..:..:..|:..:||.|||.:.
 Worm   769 SISLSLLVVLLFFIDWITNYERKRESACH---VSFQNEERDVETMQDINKILIENILPSSVAAKF 830

  Fly   480 KQTQQVPAELY----EAVTIYFSDIVGFTEIAADC---TPLEVVTFLNSIYRVFDERI---ECYD 534
            ....:...|||    |.|.:.|:.|..|.:..::.   ..||.:..||.|...||:.:   :...
 Worm   831 LSPDRAVNELYARQHENVCVMFASIPNFKDFWSEWDTNRKLECLRLLNEIVCEFDKLLSKPKFSS 895

  Fly   535 VYKVETIGDSYMVASGL----------------------PVKNGN------KHISEIATMALDLL 571
            |.|::|:|.:||.|:||                      .:::||      ..:.|.|.....:|
 Worm   896 VEKIKTVGSTYMAAAGLNESEADYDDIYLEKQNSGKYNNNIRHGNMAFRNANLMIEFALAMSQIL 960

  Fly   572 DASSVFRIPRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFGDTVNTASRMESTGEAQKIHITE 636
            ||     :.|...:..::|.|:..||:|||::|.:.|:|.::|:|||.||||::.||.:|||.|.
 Worm   961 DA-----LNRDSFQNFELRIGMSVGPLVAGVIGAQKPQYDIWGNTVNLASRMDTHGEPRKIHATT 1020

  Fly   637 EMHDSLQQVGGFRTEHRGLIDVKG-KGLMSTY 667
            :|...| |.||:|.:.||.|.||| |..|.|:
 Worm  1021 DMGRVL-QTGGYRVQSRGKIRVKGVKEPMETF 1051

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:285564
HNOBA <439..479 CDD:285003 6/39 (15%)
CYCc 459..647 CDD:214485 65/225 (29%)
Guanylate_cyc 485..669 CDD:278633 71/222 (32%)
acy-2NP_504553.1 CYCc 253..463 CDD:214485
Guanylate_cyc 308..459 CDD:278633
CYCc 817..1034 CDD:214485 68/222 (31%)
Guanylate_cyc 840..1054 CDD:278633 70/218 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.