DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33958 and Npr3

DIOPT Version :10

Sequence 1:NP_001033958.1 Gene:CG33958 / 37088 FlyBaseID:FBgn0053958 Length:710 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:139 Identity:33/139 - (23%)
Similarity:55/139 - (39%) Gaps:32/139 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 DERIE--CYDVYKVETIGDSYMVASGLPVKNGNKHISEI---ATMALDLLD-------ASSVFRI 579
            |:::|  ||  :.:|.:.:.:. ..||       |.|..   .|..|||.|       :..|..:
Mouse   201 DDKLERNCY--FTLEGVHEVFQ-EEGL-------HTSAYNFDETKDLDLDDIVRYIQGSERVVIM 255

  Fly   580 PRAGDEFVQIRCGVHTGPVVAGIVGTKMPRYCLFG-DTVNTASRMESTGEAQKIHITE--EMHDS 641
            ..:||...:|...||...:.:|       .|..|. :..|::|..:.:......|.:|  :.:.|
Mouse   256 CASGDTIRRIMLAVHRHGMTSG-------DYAFFNIELFNSSSYGDGSWRRGDKHDSEAKQAYSS 313

  Fly   642 LQQVGGFRT 650
            ||.|...||
Mouse   314 LQTVTLLRT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33958NP_001033958.1 NIT 159..396 CDD:462453
CYCc 459..647 CDD:214485 31/134 (23%)
Npr3NP_032754.2 PBP1_NPR_C 46..441 CDD:380609 33/139 (24%)
TM_EphA1 471..502 CDD:214014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.